University

[ComradeBadger]

Ahahah - this made me laugh - funny forward email D:


YOU KNOW YOU'VE BEEN IN UNIVERSITY TOO LONG WHEN...

You actually like doing laundry at home where the washing machines work.

Two miles is not too far to walk for a party.

You'd rather clean than study especially if an essay is
due.

Oh shit how did it get so late!" comes out of your mouth at least once a night.

Parents' cooking becomes something you desire, not avoid.

You schedule your classes around sleep habits and soap operas especially neighbours and Hollyoaks.

You know the pizza boy by name and don't even need to read the menu.

You go to sleep when it's light and get up when it's dark.

You live for getting mail.

Looking out the window is a form of entertainment.

Prank phone calls become funny again.

You start thinking and sounding like your friends and your accent becomes a hybrid of West Country, Surrey and general Northern.

Highlighters are the coolest things on earth.

Rearranging your room is your favourite pastime.

Rubbish cheap £1 shops are so cool.

The weekend lasts from Thursday to Monday.




BEFORE I CAME TO UNIVERSITY, I WISH I HAD KNOWN...

That it didn't matter how late my first lecture was, I'd still sleep through it.

That I could change so much and barely realize it.

That you can love a lot of people in a lot of different ways.

No matter how 'cool' you were in school, no one here cares.

That if you wear polyester everyone will ask why you are so dressed up.
That every clock on campus shows a different time.

That if you got good a-levels, so what? It doesn't matter here.

That I would go to a party the night before an exam or essay due-date.

That you can know everything and fail a test.

That you can know nothing and ace a test.

That I could get used to almost anything found out about my friends.

That most of my education would be obtained outside of lectures.

That friendship is more than getting drunk together but that's still funny......!

That Sunday is a figment of the world's imagination.

That Psychology is really Biology, that Biology is really Chemistry, that Chemistry is really Physics and that Physics is really Maths.

That my parents would become so much smarter in the last few years.

That it's possible to be alone even when you are surrounded by friends.

Don't be dismayed at good-byes, a farewell is necessary before we can meet again, and meeting again, after moments or a lifetime, is
certain for those who are friends.


TOP 10 REASONS THAT UNIVERSITY IS LIKE PRIMARY SCHOOL

10. You cry for your mother.

9. You cross the street without looking for cars.

8. Snack time is a necessity.

7. You bundle up for the outdoors without caring what you look like (because everyone else looks as stupid as you do).

6. You stay at home and play games with your friends.

5. You wear your backpack on both shoulders.

4. You wear big mittens.

3. Playing in the snow is a legitimate activity.

2. You take naps.

1. You look forward to cheese toasties.

[Absinthe]

Aye, quite a bit of that is true.

I've just got 3 days of exams and then I am packing it up back to Europe for winter break with my mates. ftw

[Glirk Dient]

1. You look forward to cheese toasties.

What the devil is a cheese toastie?

[Hectic Glenn]

Hahaha some of those sound really good fun, for when i go Uni after my gap year (if i do it). A right laugh tbh.
What the devil is a cheese toastie?
!?!?!?!? Is it not known in america or over seas what toasties are? Dear god. It involves melting cheese between two slices of toast and the sides are kinda sealed down (if you have a toastie maker!). You can add bacon or tomatoes if your feeling lucky. I wish i could still eat cheese :(

You must have heard of cheese on toast though? Its what it says if your confused.

[Glirk Dient]

Hahaha some of those sound really good fun, for when i go Uni after my gap year (if i do it). A right laugh tbh.

!?!?!?!? Is it not known in america what toasties are? Dear god. It involves melting cheese between two slices of toast and the sides are kinda sealed down (if you have a toastie maker!). You can add bacon and tomatoes if your feeling lucky. I wish i could still eat cheese :(

You must have heard of cheese on toast though? Its what it says if your confused.

Oh...we call that grilled cheese. Put cheese between 2 pieces of bread, butter the outside and cook it on a pan until both sides are brown and the cheese is melted. It's quick and easy.

[Absinthe]

Grilled cheese is awesome. I look forward to that even in the absence of university.

[kaf11]

its funny how true a lot of those are.

[$kelet0r]

it's all true :(
'cept for the parents part :x

[Beerdude26]

Oh...we call that grilled cheese. Put cheese between 2 pieces of bread, butter the outside and cook it on a pan until both sides are brown and the cheese is melted. It's quick and easy.I've got a grilled cheese maker! :O

Seriously, making grilled cheese/cheese toasties is my favourite (and only :p) cooking skill.

I even made a factory once that produces 10 X (# of persons) grilled cheese/cheese toasties per hour.

Fun for the whole family :p

[ComradeBadger]

Hahaha some of those sound really good fun, for when i go Uni after my gap year (if i do it). A right laugh tbh.

!?!?!?!? Is it not known in america or over seas what toasties are? Dear god. It involves melting cheese between two slices of toast and the sides are kinda sealed down (if you have a toastie maker!). You can add bacon or tomatoes if your feeling lucky. I wish i could still eat cheese :(

You must have heard of cheese on toast though? Its what it says if your confused.
Uni is just like that - for example me and one of my flatmates bought toy shotguns yesturday and spent the entire evening playing with them :o

[Llama]

so much for maturity :P

[Cormeh]

Farking tax dodgers!

<3

I didn't go to Uni, but thanks to mates who did, I've managed to crash a few unions, certainly isn't all bad being a student from this field. :D

[Sulkdodds]

Playing with toy guns is awesome I tell you.

....what?

[Direwolf]

Hah...I just had one happen to me.

You've been in university too long when:
You pass a dumpy 40-year old guy teacher another middle aged man the scitar in the middle of a foyer, and aren't phased.

Five minutes later I suddenly went "what the hell? I've been here too long."

[DEATH eVADER]

That every clock on campus shows a different time.

At my campus, no clocks work, shows how good the maintenance is

[Bait]

What's this "learning" thing I've been hearing about?

[jimbo118]

hehe very good, definately see some of those with me and my mates

[Evo]

Lol, nice one Badge! :thumb:

Makes me even more eager to go away for Uni! :bounce:
And before you all ask, i'll probably be going somewhere in Wales


Sister has come back with similar stories from Bristol Uni.

[ComradeBadger]

Don't go to Wales - shit nightlife!

My mate's at Aber (Fat Tony) and he has very little selection in the way of nights out - come to Lincoln, we're the party uni really :D

[Evo]

Don't go to Wales - shit nightlife!

My mate's at Aber (Fat Tony) and he has very little selection in the way of nights out - come to Lincoln, we're the party uni really :D


Thought about Lincoln actually, then i realised it is in England, and as such will have those extra Tuition Fees which i cant afford. Somewhere in Wales, for a Welshy is cheaper, and close to home (Cardiff)

As such i plan to stay in South Wales easy travelling distance to many a gig i will end up goin to :bounce:

[KagePrototype]

Come to Salford, you get to dodge packs of scallies on the way to Uni and play PS2 games on a projector. :P

[Murray_H]

Lincoln is full, of bummers!

go to durham, i went to formal toight and it was wicked! i pulled my college daughter, i really wanted liz :( time for coco pops!

[ComradeBadger]

I might be going to Durham next term for a night out :D My friend's sister is ther e :)

http://www.comrade.phenylshouse.com/stuff/uni/f20.jpg

Me wasted as **** in an old man pub, dressed as... an old man :D

[Septih]

I might be going to Durham next term for a night out :D My friend's sister is ther e :)

Let us know if you do :P

I've still yet to meet Murray_H out in durham, although i did hear a rumour that a mr Hatfield was getting auctioned off last weekend...


Oh and at durham, several of the colleges have toastie bars, i've only seen the menu for the one at castle, which had the opportunity for some rather interesting combinations, say smarties, BBQ Sauce and cheese...

At Hild Bede we have a burger van outside...

[kirovman]

There's a microwave toastie in my freezer. I win for laziness!

I miss Uni life, I'm gonna be working in a 37+ hour a week job soon :O

[Glirk Dient]

IMG

...who wears green pants? Hehe...green pants!

[oldagerocker]

:D great post Badger :D

[JNightshade]

I can't wait for this. Just two more years and it's college time!

Uni time for all you brits.

[ComradeBadger]

...who wears green pants? Hehe...green pants!
It's my old man outfit :D

I generally wear darkish jeans :)

[JNightshade]

Jeans ftw.
EDIT:naked superftw

[Murray_H]

Let us know if you do :P

I've still yet to meet Murray_H out in durham, although i did hear a rumour that a mr Hatfield was getting auctioned off last weekend...


Oh and at durham, several of the colleges have toastie bars, i've only seen the menu for the one at castle, which had the opportunity for some rather interesting combinations, say smarties, BBQ Sauce and cheese...

At Hild Bede we have a burger van outside...

I did indeed get auctioned, raised £30...woot!

I've not been out too much this term, it's easier just to stay in your house. Have you braved klute a lot?

Castle bar is nice and the toasties are too, but the sweet ones are horrible!

[The DemonWithin]

Haha, I got that exact email not too long ago, good stuff. University is definately the shit.

[Septih]

I did indeed get auctioned, raised £30...woot!

I've not been out too much this term, it's easier just to stay in your house. Have you braved klute a lot?

Castle bar is nice and the toasties are too, but the sweet ones are horrible!
I've heard bad things about klute, i only found out where it was the other week when coming back from studio let alone entered it. I don't go out loads myself so i've only been in studio, bar 19 and walkabout...

I think castle bar gets a bit crowded, but i've only been there on a wednesday night...

well done on being worth £30 :P

Edit: Know what's weird, after replying i scrolled all the way up to the top and could have sworn badger was wearing makeup as the picture whooshed by.. :|

[JNightshade]

That'd be hawtt.

[Bait]

What are some of you guys studying? By the sounds of it, it isn't all that intense now is it? Unless you guys are in your first or second year I suppose.

But then again, I don't know jack about universities in the UK.

[ComradeBadger]

I'm in the UK, I'm studying History - in my first year.

Bear in mind Lincoln is ****ing HARDCORE :D :D :D

[Hazar]

Oh shit how did it get so late!" comes out of your mouth at least once a night.


hahahaha, I do that now

[The DemonWithin]

I'm studying Biological sciences for now.

[Septih]

I'm doing Computer Science at Durham Uni, first year, somehow I manage to be lazy and keep up with work at the same time whilst everyone complains how hard it is :D

[ComradeBadger]

Wow, I know someone else who's doing Computer Science.. he said it was kinda hard on the old brain :|

So is 12 shots in as many minutes, as I discovered last night/this morning!

:|

[Murray_H]

I'm doing molecular biology and biochemistry, look at my assignment I have to do for one module:

Biotechnology Module Assessment 2005-6

The accompanying figures give maps and partial DNA sequence data for the yeast expression vector pGAPZA (a shuttle plasmid, propagated in E.coli, which is incorporated into the yeast genome by homologous recombination on transformation into Pichia pastoris), and the cDNA cloning vector pBlueScript SK- (derived from the lambda vector ZAPII by plasmid excision). In addition, sequence data for a transcript produced by Drosophila melanogaster gene CG13095, thought to encode an aspartic proteinase, is given. The transcript encodes a preproprotein; the signal peptide is removed co-translationally, and the proteinase is activated by post-translational removal of an N-terminal pro-region. Assume a full-length cDNA corresponding to the CG13095 transcript has been cloned into pBluescript SK- using a directed cloning strategy, which adds linkers to the 5’ and 3’ ends of the cDNA as shown in the strategy diagram given.

You wish to investigate the specificity of proteolysis of the aspartic proteinase encoded by CG13095. Describe a strategy for using Pichia pastoris to produce recombinant proproteinase, and for purifying the recombinant protein for subsequent activation and assay. Your final product can have extra residues at the N-terminus compared to the protein produced in Drosophila, because these extra residues do not interfere with proprotein processing, and are removed when the proprotein is activated. A C-terminal “tag” is also acceptable, as results with expression of similar enzymes as recombinant proteins have suggested it does not interfere with activity.

Give sufficient details of the operations you propose to enable a competent but unimaginative technician to carry out the experiments. Describe the expected results after each step, and outline how you would verify that each step of the procedure had proceeded as expected. You should give exact details of DNA sequences used, and provide (partial) sequence data for the final expression construct which shows how the coding sequence fits into the expression vector.

Why do you think this expression host and vector were chosen? Can you see any potential problems with the system?

(Hint 1: you will need to assemble a composite sequence showing how the protein and nucleic acid sequences fit together. You can do this by electronic or physical cut and paste.)
(Hint 2: a font with uniform character widths – Monaco or Courier – makes producing a “lined-up” nucleotide and amino acid sequence a lot easier . . .)
(Hint 3: start with the cDNA assembled into its cloning vector. You can use this as a basis for preparing restriction fragments for restriction-ligation, or as a template for PCR. Assume your technician knows about cloning PCR products into an intermediate vector – such as pCR2.1 – for checking, and to avoid having to ligate directly after PCR and restriction.)
(Hint 4: the whole business is very much easier if you work out what you want to end up with first . . .)

EMBL database entry for transcript produced by Drosophila melanogaster gene CG13095.

ID BT016133 standard; mRNA; INV; 1209 BP.
XX
AC BT016133;
XX
SV BT016133.1
XX
DT 28-OCT-2004 (Rel. 81, Created)
DT 28-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE Drosophila melanogaster GH11417 full insert cDNA.
XX
KW FLI_CDNA.
XX
OS Drosophila melanogaster (fruit fly)
OC Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera;
OC Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
OC Drosophilidae; Drosophila.
XX
RN [1]
RP 1-1209
RA Stapleton M., Carlson J., Chavez C., Frise E., George R., Pacleb J.,
RA Park S., Wan K., Yu C., Rubin G.M., Celniker S.;
RT ;
RL Submitted (27-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory,
RL One Cyclotron Road, Berkeley, CA 94720, USA
XX
CC Sequence submitted by:
CC Berkeley Drosophila Genome Project
CC Lawrence Berkeley National Laboratory
CC Berkeley, CA 94720
CC This clone was sequenced as part of a high-throughput process to
CC sequence clones from Drosophila Gene Collection (Rubin et al.,
CC Science 2000, Stapleton et al., Genome Biology 2002). The sequence
CC has been subjected to integrity checks for sequence accuracy,
CC presence of a polyA tail and contiguity within 100 kb in the
CC genome. Thus we believe the sequence to reflect accurately this
CC particular cDNA clone. However, there are artifacts associated with
CC the generation of cDNA clones that may have not been detected in
CC our initial analyses such as internal priming, priming from
CC contaminating genomic DNA, retained introns due to reverse
CC transcription of unspliced precursor RNAs, and reverse
CC transcriptase errors that result in single base changes. For
CC further information about this sequence, including its location and
CC relationship to other sequences, please visit our Web site
CC (http://fruitfly.berkeley.edu) or send email to cdna@fruitfly.org.
XX
FH Key Location/Qualifiers
FH
FT source 1..1209
FT /db_xref="taxon:7227"
FT /mol_type="mRNA"
FT /organism="Drosophila melanogaster"
FT /strain="y; cn bw sp"
FT /map="29D2-29D2"
FT gene 1..1209
FT /note="blastp alignment with CG13095-RA"
FT /gene="CG13095"
FT CDS 22..1140
FT /codon_start=1
FT /db_xref="FLYBASE:FBgn0032049"
FT /db_xref="GOA:Q9VLK3"
FT /db_xref="InterPro:IPR001461"
FT /db_xref="InterPro:IPR001969"
FT /db_xref="InterPro:IPR009007"
FT /db_xref="UniProtKB/TrEMBL:Q9VLK3"
FT /note="Longest ORF"
FT /gene="CG13095"
FT /product="GH11417p"
FT /protein_id="AAV37018.1"
FT /translation="MFKTIAVVVLLAALASAELHRVPILKEQNFVKTRQNVLAEKSYLR
FT TKYQLPSLRSVDEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCKSDA
FT CLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEP
FT GTNFNDANFDGILGMAYESLAVDGVAPPFYNMVSQGLVDNSVFSFYLARDGTSTMGGEL
FT IFGGSDASLYSGALTYVPISEQGYWQFTMAGSSIDGYSLCDDCQAIADTGTSLIVAPYN
FT AYITLSEILNVGEDGYLDCSSVSSLPDVTFNIGGTNFVLKPSAYIIQSDGNCMSAFEYM
FT GTDFWILGDVFIGQYYTEFDLGNNRIGFAPVA"
XX
SQ Sequence 1209 BP; 275 A; 372 C; 288 G; 274 T; 0 other;
agtagactag aaaccaagag aatgttcaag accatcgctg tagtagtgct cctggcagcc 60
ctggccagtg ccgagctcca tcgcgtgccg atcctcaagg agcagaactt tgtgaagacg 120
cgtcagaatg ttttggccga gaaatcctat ctgcgcacca agtaccagct gccctcgctt 180
cgcagcgtgg atgaggaaca gctgtccaac tcgatgaata tggcttacta cggagccatc 240
tccatcggaa ctcccgctca gagcttcaag gttctgttcg actcaggctc ctcgaacctg 300
tgggtgccat cgaacacctg caagagcgat gcctgcctga cccacaacca gtacgactcc 360
agcgccagct ccacctacgt ggccaacggc gaatccttct ccatccagta tggcactggc 420
agcctaactg gctacctgtc caccgatacc gtcgacgtca atggcctgag catccagagc 480
cagacctttg ctgaatccac caacgagccg ggcaccaact tcaacgatgc caacttcgat 540
ggcattctcg gtatggccta tgagtccctg gccgtggatg gtgtggctcc tccgttctac 600
aacatggtgt cccagggtct ggtcgacaac tccgtcttct cgttctatct ggcccgcgat 660
ggcacctcca ctatgggtgg tgaactcatc ttcggtggct ccgatgcctc tctgtactct 720
ggcgctctga cctacgttcc catctcggag cagggctact ggcagttcac catggctgga 780
tcctccattg acggttactc gctgtgtgat gattgccagg ctattgccga taccggcacc 840
tccctgatcg tggctcccta caatgcttac attaccctct ccgagatcct gaacgtgggt 900
gaggatggct atctggactg ctcaagcgtc agctccctgc ccgatgtcac cttcaacatc 960
ggtggcacca acttcgtcct gaagccctcg gcctacatca tccagtcgga cggcaactgt 1020
atgtccgcct tcgagtacat gggcaccgac ttctggattc tgggcgatgt cttcattggc 1080
cagtactaca ccgagttcga tttgggcaac aaccgcattg gcttcgcccc agtcgcctaa 1140
ttaacgatcc gcaattacga atcaataaag aaacgagctc ttaaaaaaaa aaaaaaaaaa 1200
aaaaaaaaa 1209
//

Notes
1) “CDS” above refers to the coding sequence, which runs from nucleotides 22 (start codon) to 1140 (stop codon).
2) The sequence given corresponds to a full length cDNA. (Note the poly(A) tail at the 3’ end of the mRNA.) Assume the linkers for cDNA cloning fit directly onto the sequence given.
3) In the translated sequence given, amino acids 1-17 correspond to a predicted signal peptide (see http://www.cbs.dtu.dk/services/SignalP/), which is removed co-translationally in vivo (in Drosophila). The protein product after translation starts at amino acid 18.


I don't even know where to start :|

[Cormeh]

Well, that's you boned.

[kirovman]

:O is that a year long assignment, half-year or what?

[Murray_H]

:O is that a year long assignment, half-year or what?

Over christmas, along with 2 summative write-ups for practicals, and one formative

Merry christmas to me!

[Glirk Dient]

Over christmas, along with 2 summative write-ups for practicals, and one formative

Merry christmas to me!

Owned by school!

[Harryz]

I was soo close to choosing Biochemistry, thank god I didn't. I'm thinking of medical science or clinical sciences. Eugh, me confused.

[ComradeBadger]

I don't have ANY work over Christmas :D :D

gg Semester system :E

[kirovman]

Last year I had a lab report to type up over Christmas, and exams to revise for. This year I'm unemployed/going into full-time employment after the new year... Merry Christmas to me! :cheers:

[oldagerocker]

I got 2 project folders to type up, a biogeography assignment and a hurricane risk research plan to finish. I'm going to try and get it all done before christmas!

[$kelet0r]

Winter exams FTL :(

[Sanada]

I've got so much work at the moment. Dissertation, multiple assignments to complete (gotta hand one in on the 9th). Third and last year is always the hardest.

Gonna have so much fun over Christmas with these... :|

[ComradeBadger]

In fairness, right now I have about 4 big-arse essays for the Monday :|

But but the parties the parties :D